HORDB

General Information

ID: hor001961
Uniprot ID: P81401
Protein name: Intestinal peptide PHI-27
Gene name: VIP
Organism: Bos taurus (Bovine)
Family: Glucagon family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0051428 peptide hormone receptor binding
GO BP: GO:0001938 positive regulation of endothelial cell proliferation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007611 learning or memory; GO:0032812 positive regulation of epinephrine secretion; GO:0032880 regulation of protein localization; GO:0043066 negative regulation of apoptotic process; GO:0043267 negative regulation of potassium ion transport; GO:0045732 positive regulation of protein catabolic process; GO:0048242 epinephrine secretion; GO:0048255 mRNA stabilization; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0060406 positive regulation of penile erection; GO:0070459 prolactin secretion
GO CC: GO:0005576 extracellular region; GO:0043005 neuron projection

Sequence Information

Sequence: HADGVFTSDYSRLLGQLSAKKYLESLI
Length: 27
Propeptide: METRSKPQLLVFLTLFSVLFSQTLAWPLFGAPSALRMGDRIPFEGANEPDQVSLKADTDILQDALAENDTPYYDVSRNVRHADGVFTSDYSRLLGQLSAKKYLESLIGKRVSNSISEDQGPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFLEELEK
Signal peptide: METRSKPQLLVFLTLFSVLFSQTLA
Modification: T27 Isoleucine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Cause vasodilation
Mechanism: NA
Cross BBB: NA
Target: VIPR1, VIPR2
Target Unid: F1MF07, F1MIT6
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P81401-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001961_AF2.pdb

hor001961_ESM.pdb

Physical Information

Mass:	347636	Formula:	C136H215N35O42
Absent amino acids:	CMNPW	Common amino acids:	L
pI:	7.53	Basic residues:	4
Polar residues:	9	Hydrophobic residues:	10
Hydrophobicity:	-10	Boman Index:	-3488
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	104.81
Instability Index:	2075.19	Extinction Coefficient cystines:	2980
Absorbance 280nm:	114.62

Literature

PubMed ID: 6548446
Title: A novel form of the polypeptide PHI isolated in high yield from bovine upper intestine. Relationships to other peptides of the glucagon-secretin family.